PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016504131.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 336aa    MW: 36137.2 Da    PI: 7.6819
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016504131.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.8e-1298142347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
   XP_016504131.1  98 PWTEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKY 142
                      8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.93991147IPR017930Myb domain
SuperFamilySSF466897.25E-1793148IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-1994146IPR006447Myb domain, plants
SMARTSM007178.0E-1195145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-1195141IPR009057Homeodomain-like
PfamPF002491.1E-1098142IPR001005SANT/Myb domain
CDDcd001672.65E-998143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MTRRCSHCST NGHNSRTCPN RGVKLFGVRL TDGLIRKSAS MGNLTHFASS SGPLNGAVHD  60
SPGNTPDHPA VGGSADGYAS EDFVAGSSSS RERKKGVPWT EEEHRMFLLG LQKLGKGDWR  120
GIARNYVISR TPTQVASHAQ KYFIRQSNMS RRKRRSSLFD IVADESGDTP MVSRDFLADD  180
PPQGEMQSNN PLPPTPSVDE ECESMGSVAS ANSNDGELSV PKQESSQYPH PLVYPAYVAP  240
FFPMPYPCWP GYTAEPAKAE THEVLKPTAV HSKSPINVDE LVGMSKLSLG ESIGDAKPSS  300
LSLKLVEGSS RQSAFHANPS SGSSGMNSSH SPIHAV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankS747530.0S74753.1 mybSt1=Myb-related transcriptional activator [Solanum tuberosum=potatoes, leaf, mRNA, 1465 nt].
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009783628.10.0PREDICTED: transcription factor MYB1R1 isoform X1
RefseqXP_016504131.10.0PREDICTED: transcription factor MYB1R1-like isoform X1
TrEMBLM1CHD30.0M1CHD3_SOLTU; Uncharacterized protein
TrEMBLA0A0V0IA260.0A0A0V0IA26_SOLCH; Putative MYBST1 protein-like
STRINGPGSC0003DMT4000674890.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70622431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-131MYB_related family protein